PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AL_B68E59AAB.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 151aa    MW: 16964.4 Da    PI: 10.4409
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AL_B68E59AAB.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.6e-164289148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+ Ed +l  +vk++G  +W+ + +  g+ R++k+c++rw ++l
  Traes_1AL_B68E59AAB.2 42 KGPWTPAEDAILEAYVKKHGVQNWNVVQKDTGLLRCGKSCRLRWANHL 89
                           79******************************99**********9996 PP

2Myb_DNA-binding25.62.9e-0895126134
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkg 34 
                            +g +T+eE+ l+++++ ++G++ W++ a+++   
  Traes_1AL_B68E59AAB.2  95 KGTFTKEEENLIIKLHSKMGNK-WARMAARVS-S 126
                            799*******************.*****9987.5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.813793IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-223892IPR009057Homeodomain-like
SMARTSM007172.0E-134191IPR001005SANT/Myb domain
PfamPF002491.6E-144289IPR001005SANT/Myb domain
SuperFamilySSF466893.59E-2443119IPR009057Homeodomain-like
CDDcd001671.48E-104489No hitNo description
PROSITE profilePS500906.72590131IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.7E-1493124IPR009057Homeodomain-like
SMARTSM007171.294130IPR001005SANT/Myb domain
PfamPF002492.4E-795127IPR001005SANT/Myb domain
CDDcd001670.0023397124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MTRAKSESDR VMPGPDQVDL ASHDDDSARE SPRRRAGPQL KKGPWTPAED AILEAYVKKH  60
GVQNWNVVQK DTGLLRCGKS CRLRWANHLR PDLKKGTFTK EEENLIIKLH SKMGNKWARM  120
AARVSSLSSS CFSGSAFIKF CSHASLMRVD I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-2038121385B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519000.0JF951900.1 Triticum aestivum clone TaMYB15 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564452.17e-54PREDICTED: transcription factor GAMYB-like
SwissprotA2WW877e-55GAM1_ORYSI; Transcription factor GAMYB
TrEMBLW4ZS801e-110W4ZS80_WHEAT; Uncharacterized protein
STRINGBRADI2G53010.12e-53(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39473664
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.21e-43myb domain protein 101
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]